Structure of PDB 4v19 Chain S Binding Site BS02

Receptor Information
>4v19 Chain S (length=143) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQ
HHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCL
EAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE
Ligand information
>4v19 Chain B (length=62) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auuaauauaauuuaaaaauaaaauauuaaaaauauuuaaauaaauuaauu
uuauaaauauua
<<<.<<<..<<<<..>>>>.<<<<<<.....>>>>>>....<<<<..>>>
>>>>.>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v19 The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R85 T86 Q87 H89 K113 V122 W151 S155 S157
Binding residue
(residue number reindexed from 1)		R48 T49 Q50 H52 K76 V85 W114 S118 S120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v19, PDBe:4v19, PDBj:4v19
PDBsum4v19
PubMed25271403
UniProtA0A0R4J8D5

[Back to BioLiP]