Structure of PDB 4u67 Chain S Binding Site BS02

Receptor Information

>4u67 Chain S (length=175) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTG
LFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHT
TGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAG
DIKLPEGCTLAADPELTVVSVLPPR

Ligand information

>4u67 Chain Y (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cacccccgugcccauagcacuguggaaccaccccaccccaugccgaacug
ggucgugaaacacagcagcgccaaugauacucggaccgcagggucccgga
aaagucggucagcgcggggguu

.<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>
>>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>.
......>>>..>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4u67 The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
Resolution	3.65 Å
Binding residue (original residue number in PDB)	V22 Y24 N25 N29 K67 R74 H80 D82 Y84
Binding residue (residue number reindexed from 1)	V22 Y24 N25 N29 K67 R74 H80 D82 Y84

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u67, PDBe:4u67, PDBj:4u67
PDBsum	4u67
PubMed	28689968
UniProt	Q9RX88\|RL25_DEIRA Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]