Structure of PDB 4ioa Chain S Binding Site BS02

Receptor Information
>4ioa Chain S (length=175) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTG
LFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHT
TGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAG
DIKLPEGCTLAADPELTVVSVLPPR
Ligand information
>4ioa Chain Y (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacccccgugcccauagcacuguggaaccaccccaccccaugccgaacug
ggucgugaaacacagcagcgccaaugauacucggaccgcagggucccgga
aaagucggucagcgcggggguu
.<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>
>>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>.
......>>>..>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
R8 K11 V22 Y24 N25 K26 K67 R74 H80 D82 Y84
Binding residue
(residue number reindexed from 1)
R8 K11 V22 Y24 N25 K26 K67 R74 H80 D82 Y84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum4ioa
PubMed23414806
UniProtQ9RX88|RL25_DEIRA Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]