Structure of PDB 3pio Chain S Binding Site BS02

Receptor Information
>3pio Chain S (length=175) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTG
LFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHT
TGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAG
DIKLPEGCTLAADPELTVVSVLPPR
Ligand information
>3pio Chain Y (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acccccgugcccauagcacuguggaaccaccccaccccaugccgaacugg
gucgugaaacacagcagcgccaaugauacucggaccgcagggucccggaa
aagucggucagcgcgggggu
<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>..
.....>>>..>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
Resolution3.2473 Å
Binding residue
(original residue number in PDB)
V22 Y24 N25 R74 H80
Binding residue
(residue number reindexed from 1)
V22 Y24 N25 R74 H80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3pio, PDBe:3pio, PDBj:3pio
PDBsum3pio
PubMed21282615
UniProtQ9RX88|RL25_DEIRA Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]