Structure of PDB 2zjp Chain S Binding Site BS02

Receptor Information

>2zjp Chain S (length=175) Species: 1299 (Deinococcus radiodurans)

MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTG
LFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHT
TGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAG
DIKLPEGCTLAADPELTVVSVLPPR

Ligand information

>2zjp Chain Z (length=122)

cacccccgugcccauagcacuguggaaccaccccaccccaugccgaacug
ggucgugaaacacagcagcgccaaugauacucggaccgcagggucccgga
aaagucggucagcgcggggguu

.<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>
>>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>.
......>>>..>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): V22 Y24 N25 K67 R74 I79 H80 D82 Y84
• Binding residue (residue number reindexed from 1): V22 Y24 N25 K67 R74 I79 H80 D82 Y84

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
• PDBsum: 2zjp
• PubMed: 18406324
• UniProt: Q9RX88|RL25_DEIRA Large ribosomal subunit protein bL25 (Gene Name=rplY)