Structure of PDB 6nuo Chain RS Binding Site BS02

Receptor Information

>6nuo Chain RS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>6nuo Chain RB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6nuo Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): R10 K11 R15 K19 R25 F29 R30 S31 L32 K33 Y36 Q38 G45 T47 K59 N61 K62 T63 Y92 K93 H95 R97
• Binding residue (residue number reindexed from 1): R9 K10 R14 K18 R24 F28 R29 S30 L31 K32 Y35 Q37 G44 T46 K58 N60 K61 T62 Y91 K92 H94 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6nuo, PDBe:6nuo, PDBj:6nuo
• PDBsum: 6nuo
• PubMed: 33016876
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)