Structure of PDB 6ndk Chain RS Binding Site BS02

Receptor Information

>6ndk Chain RS (length=110) Species: 300852 (Thermus thermophilus HB8)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>6ndk Chain RB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<........<<<<<<<....>>>>>>>...
.....>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ndk Importance of a tRNA anticodon loop modification and a conserved, noncanonical anticodon stem pairing intRNACGGProfor decoding
• Resolution: 3.64 Å
• Binding residue (original residue number in PDB): K11 R15 R25 F29 R30 S31 L32 K33 Y36 Q38 G45 V46 T47 L54 G60 N61 T63 H95 G96 R97
• Binding residue (residue number reindexed from 1): K9 R13 R23 F27 R28 S29 L30 K31 Y34 Q36 G43 V44 T45 L52 G58 N59 T61 H93 G94 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ndk, PDBe:6ndk, PDBj:6ndk
• PDBsum: 6ndk
• PubMed: 30782843
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)