Structure of PDB 6bz8 Chain RS Binding Site BS02

Receptor Information

>6bz8 Chain RS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>6bz8 Chain RB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6bz8 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
• Resolution: 3.74 Å
• Binding residue (original residue number in PDB): R10 R15 R30 S31 L32 K33 Y36 G45 V46 T63 Y92 H95 R97
• Binding residue (residue number reindexed from 1): R9 R14 R29 S30 L31 K32 Y35 G44 V45 T62 Y91 H94 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bz8, PDBe:6bz8, PDBj:6bz8
• PDBsum: 6bz8
• PubMed: 30476222
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)