Structure of PDB 6buw Chain RS Binding Site BS02

Receptor Information

>6buw Chain RS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>6buw Chain RB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6buw Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 G45 V46 T47 S50 L54 K62 T63 K93 H95 G96
• Binding residue (residue number reindexed from 1): R14 R24 F28 R29 S30 L31 K32 H33 Y35 Q37 G44 V45 T46 S49 L53 K61 T62 K92 H94 G95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6buw, PDBe:6buw, PDBj:6buw
• PDBsum: 6buw
• PubMed: 30476222
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)