Structure of PDB 4tuc Chain RS Binding Site BS02

Receptor Information

>4tuc Chain RS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>4tuc Chain RB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4tuc Structural insights into translational recoding by frameshift suppressor tRNASufJ.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): R15 K19 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 I40 G45 V46 T47 S50 L54 A55 K57 N61 K62 T63 Y92 K93 H95 G96 R97
• Binding residue (residue number reindexed from 1): R14 K18 R24 F28 R29 S30 L31 K32 H33 Y35 Q37 I39 G44 V45 T46 S49 L53 A54 K56 N60 K61 T62 Y91 K92 H94 G95 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4tuc, PDBe:4tuc, PDBj:4tuc
• PDBsum: 4tuc
• PubMed: 25352689
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)