Structure of PDB 4lnt Chain RS Binding Site BS02

Receptor Information

>4lnt Chain RS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>4lnt Chain RB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4lnt Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
• Resolution: 2.94 Å
• Binding residue (original residue number in PDB): R15 R25 F29 R30 S31 L32 K33 Y36 Q38 G45 V46 T47 S50 A55 K57 N61 K62 T63 K93 H95 R97
• Binding residue (residue number reindexed from 1): R14 R24 F28 R29 S30 L31 K32 Y35 Q37 G44 V45 T46 S49 A54 K56 N60 K61 T62 K92 H94 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4lnt, PDBe:4lnt, PDBj:4lnt
• PDBsum: 4lnt
• PubMed: 25128388
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)