Structure of PDB 8pfr Chain RN Binding Site BS02

Receptor Information
>8pfr Chain RN (length=50) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASHKTFRIKRFLAKKQKQNRPIPQWIQMKTGNKIMYNSKRRHWRRTKLGL
Ligand information
>8pfr Chain LD (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		F7 R8 R11 K15 K18 Q19 R21 I23 P24 W26 M29 K30 T31 I35 K40
Binding residue
(residue number reindexed from 1)		F6 R7 R10 K14 K17 Q18 R20 I22 P23 W25 M28 K29 T30 I34 K39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0007283 spermatogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum8pfr
PubMed
UniProtQ9CQD0|RL39L_MOUSE Large ribosomal subunit protein eL39-like (Gene Name=Rpl39l)

[Back to BioLiP]