Structure of PDB 8p8n Chain RH Binding Site BS02

Receptor Information
>8p8n Chain RH (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA
Ligand information
>8p8n Chain LD (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		K5 A6 Y7 R10 P42 R48 K49 A52 L55 T56 N59 R63 K78 K83 T85 R86 R89
Binding residue
(residue number reindexed from 1)		K4 A5 Y6 R9 P41 R47 K48 A51 L54 T55 N58 R62 K77 K82 T84 R85 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum8p8n
PubMed
UniProtP0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)

[Back to BioLiP]