Structure of PDB 8wk3 Chain R Binding Site BS02

Receptor Information
>8wk3 Chain R (length=108) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLK
GMMNVLQG
Ligand information
>8wk3 Chain f (length=21) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wk3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state
Resolution3.3 Å
Binding residue
(original residue number in PDB)
Q39 Y87 R88 V89 D91 S94 L95 G97
Binding residue
(residue number reindexed from 1)
Q37 Y59 R60 V61 D63 S66 L67 G69
External links
PDB RCSB:8wk3, PDBe:8wk3, PDBj:8wk3
PDBsum8wk3
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]