Structure of PDB 8p2g Chain R Binding Site BS02

Receptor Information

>8p2g Chain R (length=119) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKG
VTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYL
YHGRVKALAEAARESGLEF

Ligand information

>8p2g Chain B (length=113)

cuggugacuauagcaaggaggucacaccuguucccaugccgaacacagaa
guuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagua
gaacguugccagg

<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>>.<<......<<<.<<<<....>>>>.>>>......
>>..>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
• Resolution: 2.02 Å
• Binding residue (original residue number in PDB): K4 D6 K7 K9 R11 H15 R19 R30 N32 Y34 R35 S36 N37 K38 H39 Y41 Q43 G50 V51 T52 Q55 T68 K69 V70 H102 G103 R104
• Binding residue (residue number reindexed from 1): K4 D6 K7 K9 R11 H15 R19 R30 N32 Y34 R35 S36 N37 K38 H39 Y41 Q43 G50 V51 T52 Q55 T68 K69 V70 H102 G103 R104

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
• PDBsum: 8p2g
• PubMed: 38902339
• UniProt: Q2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)