Structure of PDB 8kd5 Chain R Binding Site BS02

Receptor Information
>8kd5 Chain R (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
Ligand information
>8kd5 Chain Y (length=160) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccctggagaatcccggtgccgaggccgctcaattggtcgtagacagctct
agcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaa
ggggattactccctagtctccaggcacgtgtcagatatatacatcctgtt
ctagagcggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kd5 Structural basis of nucleosome deacetylation and DNA linker tightening by Rpd3S histone deacetylase complex.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		T29 R30 Y39 G50 I51 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)		T2 R3 Y12 G23 I24 S25 S26 R56 S57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8kd5, PDBe:8kd5, PDBj:8kd5
PDBsum8kd5
PubMed37666978
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]