Structure of PDB 7o72 Chain R Binding Site BS02

Receptor Information
>7o72 Chain R (length=261) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVFDGNDIENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNL
HGQELGKIRINKDGSKITLLLNENDNDSIPHEYDLELTKKVVENEYVFTE
QNLKKYQRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQR
RNIVKLNNKERITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIK
SIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLV
KYTLRPEYKKL
Ligand information
>7o72 Chain T (length=65) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atgtatgtacaacacacatcggaggtgaatcgaacgttccatagctatta
tatacacagcgtgct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o72 Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K330 L339
Binding residue
(residue number reindexed from 1)		K240 L249
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0000993 RNA polymerase II complex binding
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006355 regulation of DNA-templated transcription
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005674 transcription factor TFIIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o72, PDBe:7o72, PDBj:7o72
PDBsum7o72
PubMed34133942
UniProtP41896|T2FB_YEAST Transcription initiation factor IIF subunit beta (Gene Name=TFG2)

[Back to BioLiP]