Structure of PDB 7nhn Chain R Binding Site BS02

Receptor Information
>7nhn Chain R (length=118) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITKIDKNKVRKKRHARVRSKISGTESRPRLNVFRSNKNIYAQIIDDVNGV
TLASASNLDKDFGSAESKVDAASKVGELVAKRASEKGITSVTFDRGGYLY
HGRVKALAEAARENGLEF
Ligand information
>7nhn Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugguaguuauggcgagaaggucacacccguucccaucccgaacacggua
guuaagcuucucugcgccaaugguaguugggggcuucccccugcgagagu
aggucgcugccggg
<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>><<<.......<<.<<<<<...>>>>>.>>......
.>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
K4 D6 K7 K9 R11 H15 R19 N32 R35 S36 N37 K38 N39 Y41 Q43 G50 V51 T52 L59 S68 V70 L100 H102 G103 R104
Binding residue
(residue number reindexed from 1)
K3 D5 K6 K8 R10 H14 R18 N31 R34 S35 N36 K37 N38 Y40 Q42 G49 V50 T51 L58 S67 V69 L99 H101 G102 R103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7nhn, PDBe:7nhn, PDBj:7nhn
PDBsum7nhn
PubMed34117249
UniProtQ8Y445|RL18_LISMO Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]