Structure of PDB 7nhl Chain R Binding Site BS02

Receptor Information

>7nhl Chain R (length=118) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

ISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGV
TLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLY
HGRVKALAEAARESGLEF

Ligand information

>7nhl Chain B (length=113)

cuggugacuauagcaaggaggucacaccuguucccaugccgaacacagaa
guuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagua
gaacguugccagg

<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>>.<<.....<<<<.<<<<....>>>>.>>>..>...
>>..>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7nhl Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): K4 D6 K7 R11 H15 R19 R30 N32 Y34 R35 S36 N37 K38 Y41 Q43 G50 Q55 K59 K69 H102 G103 R104
• Binding residue (residue number reindexed from 1): K3 D5 K6 R10 H14 R18 R29 N31 Y33 R34 S35 N36 K37 Y40 Q42 G49 Q54 K58 K68 H101 G102 R103

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nhl, PDBe:7nhl, PDBj:7nhl
• PDBsum: 7nhl
• PubMed: 34117249
• UniProt: Q2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)