Structure of PDB 6lu8 Chain R Binding Site BS02

Receptor Information
>6lu8 Chain R (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IHPYSRKAAQITREAHKQEKKEKLKNEKALRLNLVGEKLQWFQNHLDPQK
KRYSKKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQT
MERERQQFEGYGLEIPDILNASNLKTFREWDFDLKKLPNIKMRKICANDA
Ligand information
>6lu8 Chain 5 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lu8 Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
Resolution3.13 Å
Binding residue
(original residue number in PDB)		R29 H32 K36 K44 R47 K151 P154 N155
Binding residue
(residue number reindexed from 1)		R13 H16 K20 K28 R31 K135 P138 N139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:1990275 preribosome binding
Biological Process
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lu8, PDBe:6lu8, PDBj:6lu8
PDBsum6lu8
PubMed32669547
UniProtQ96EY4|TMA16_HUMAN Translation machinery-associated protein 16 (Gene Name=TMA16)

[Back to BioLiP]