Structure of PDB 5lmr Chain R Binding Site BS02

Receptor Information
>5lmr Chain R (length=73) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRI
LAKTIKRARILGLLPFTEKLVRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lmr Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
Resolution4.45 Å
Binding residue
(original residue number in PDB)		R18 K19
Binding residue
(residue number reindexed from 1)		R3 K4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lmr, PDBe:5lmr, PDBj:5lmr
PDBsum5lmr
PubMed27662086
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]