Structure of PDB 5lj5 Chain R Binding Site BS02

Receptor Information
>5lj5 Chain R (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYNGIGLKSAKGSSTSGHVQRSLASNNRRRPQGSQQQRQQRQNAIKKASI
ETHMEKREIEVQVSELRDRLEEEETLSEEQIDKKCEALRAKLTNEWQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lj5 Cryo-EM structure of the spliceosome immediately after branching.
Resolution10.0 Å
Binding residue
(original residue number in PDB)
Y3 T16 S17 H19 V20
Binding residue
(residue number reindexed from 1)
Y2 T15 S16 H18 V19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5lj5, PDBe:5lj5, PDBj:5lj5
PDBsum5lj5
PubMed27459055
UniProtQ03375|CWC21_YEAST Pre-mRNA-splicing factor CWC21 (Gene Name=CWC21)

[Back to BioLiP]