Structure of PDB 5li0 Chain R Binding Site BS02

Receptor Information

>5li0 Chain R (length=119) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKG
VTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYL
YHGRVKALAEAARESGLEF

Ligand information

>5li0 Chain B (length=114)

ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaaggucuuuagcgacgaugguagccaacuuacguuccgcuagagua
gaacguugccaggc

.<<.<..<.....<<<<<<<......<<<<<...............>>>.
.>>.....>>>>>.>><....<<...<.<............>.>....>>
...>..>..>.>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): K4 D6 K7 K9 R11 H15 R19 R30 R35 S36 N37 H39 Q43 G50 V51 T52 Q55 K59 D60 A67 K69 H102 G103 R104
• Binding residue (residue number reindexed from 1): K4 D6 K7 K9 R11 H15 R19 R30 R35 S36 N37 H39 Q43 G50 V51 T52 Q55 K59 D60 A67 K69 H102 G103 R104

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5li0, PDBe:5li0, PDBj:5li0
• PDBsum: 5li0
• PubMed: 27906650
• UniProt: Q2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)