Structure of PDB 5gmk Chain R Binding Site BS02

Receptor Information
>5gmk Chain R (length=261) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTSWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSP
FALQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIG
KLALRTEVLDCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKH
LKPAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMS
NQTLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQEELKLESLNMM
VHLINNNTNSA
Ligand information
>5gmk Chain L (length=127) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuug
uaacaacuaaugaccucagaggcucaauuuguuacaauacauuuuuuggc
accgcgacccucgcacuuguggagucg
................................................<<
<<<<<<.<...<.<<<<.>>>>.>..>.>>>>>>>>..............
..<<...<<...........>>...>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gmk Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
Resolution3.4 Å
Binding residue
(original residue number in PDB)		L151 Q155
Binding residue
(residue number reindexed from 1)		L151 Q155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0017070 U6 snRNA binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033120 positive regulation of RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
GO:0045787 positive regulation of cell cycle
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gmk, PDBe:5gmk, PDBj:5gmk
PDBsum5gmk
PubMed27445308
UniProtQ12046|CWC2_YEAST Pre-mRNA-splicing factor CWC2 (Gene Name=CWC2)

[Back to BioLiP]