Structure of PDB 4wht Chain R Binding Site BS02

Receptor Information
>4wht Chain R (length=215) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQTTPTLSATIGQSVSISCRSSQSLLESDGNTYLNWLLQRPGQSPQ
LLIYSVSNLESGVPNRFSGSGSETDFTLKISGVEAEDLGVYYCMQTTHAP
TFGAGTKLELKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISV
KWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEV
VHKTSSSPVVKSFNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wht Structural flexibility of a conserved antigenic region in hepatitis C virus glycoprotein e2 recognized by broadly neutralizing antibodies.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		E31 Y37 T96 T97 H98 A99 P100
Binding residue
(residue number reindexed from 1)		E31 Y37 T96 T97 H98 A99 P100
External links