Structure of PDB 3jxc Chain R Binding Site BS02

Receptor Information
>3jxc Chain R (length=66) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLA
LSKALQCSPDYLLKGD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jxc Sequence Recognition of DNA by Protein-Induced Conformational Transitions.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R11 R20 Q21 V33 S36 R40
Binding residue
(residue number reindexed from 1)		R9 R18 Q19 V31 S34 R38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3jxc, PDBe:3jxc, PDBj:3jxc
PDBsum3jxc
PubMed20053356
UniProtP69202|RPC2_BPP22 Repressor protein C2 (Gene Name=C2)

[Back to BioLiP]