Structure of PDB 1rpe Chain R Binding Site BS02

Receptor Information
>1rpe Chain R (length=63) Species: 10712 (Phage 434) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELAS
ALGVSVDWLLNGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rpe The phage 434 OR2/R1-69 complex at 2.5 A resolution.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q29 S30 Q33 T39 K40 R41 R43 F44
Binding residue
(residue number reindexed from 1)		Q29 S30 Q33 T39 K40 R41 R43 F44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1rpe, PDBe:1rpe, PDBj:1rpe
PDBsum1rpe
PubMed8355273
UniProtP16117|RPC1_BP434 Repressor protein CI (Fragment) (Gene Name=CI)

[Back to BioLiP]