Structure of PDB 8fom Chain QI Binding Site BS02

Receptor Information
>8fom Chain QI (length=127) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSKR
Ligand information
>8fom Chain QV (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggucguuagcucaggguagagcaguugauuuuuaaucaauuggucgcag
guucgaauccugcacgacccacca
<<<<<<<..<<<<......>>>>.<<<<<<.....>>>>>>.....<<<<
<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fom Structural basis for reduced ribosomal A-site fidelity in response to P-site codon-anticodon mismatches.
Resolution3.58 Å
Binding residue
(original residue number in PDB)
K127 R128
Binding residue
(residue number reindexed from 1)
K126 R127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fom, PDBe:8fom, PDBj:8fom
PDBsum8fom
PubMed36924943
UniProtP80374|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]