Structure of PDB 8wlh Chain Q Binding Site BS02

Receptor Information
>8wlh Chain Q (length=119) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRGREETGGVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQ
MGLTVLGSQLKGMMNVLQG
Ligand information
>8wlh Chain d (length=20) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wlh Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state
Resolution3.7 Å
Binding residue
(original residue number in PDB)		Y87 V89 S94
Binding residue
(residue number reindexed from 1)		Y70 V72 S77
External links
PDB RCSB:8wlh, PDBe:8wlh, PDBj:8wlh
PDBsum8wlh
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]