Structure of PDB 8uu6 Chain Q Binding Site BS02

Receptor Information
>8uu6 Chain Q (length=112) Species: 1642 (Listeria innocua) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKVRKKRHARVRSKISGTESRPRLNVFRSNKNIYAQVIDDVNGVTLASAS
NLDKDFGSAESKVDAASKVGELVAKRASEKGITSVTFDRGGYLYHGRVKA
LAEAARENGLEF
Ligand information
>8uu6 Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugguaguuauggcgagaaggucacacccguucccaucccgaacacggua
guuaagcuucucugcgccaaugguaguugggggcuucccccugcgagagu
aggucgcugccggg
<<<<<<<<....<<<<<<<<.....<<<<<<.............>>>>..
>>....>>>>>>.>><<<.......<<.<<<<<...>>>>>.>>......
.>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uu6 Mechanistic insights into the alternative ribosome recycling by HflXr.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R19 N32 R35 S36 N37 K38 T52 K69 H102 G103 R104
Binding residue
(residue number reindexed from 1)		R12 N25 R28 S29 N30 K31 T45 K62 H95 G96 R97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uu6, PDBe:8uu6, PDBj:8uu6
PDBsum8uu6
PubMed38407413
UniProtA0A0U5AR65

[Back to BioLiP]