Structure of PDB 8uk9 Chain Q Binding Site BS02

Receptor Information
>8uk9 Chain Q (length=183) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTK
CSIAQKSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPR
GKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLV
LKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uk9 Autoinhibition of a clamp-loader ATPase revealed by deep mutagenesis and cryo-EM
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K62 F63
Binding residue
(residue number reindexed from 1)		K58 F59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
Biological Process
GO:0006260 DNA replication
GO:0039686 bidirectional double-stranded viral DNA replication
GO:0039693 viral DNA genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8uk9, PDBe:8uk9, PDBj:8uk9
PDBsum8uk9
PubMed38177685
UniProtP04527|LOADS_BPT4 Sliding-clamp-loader small subunit (Gene Name=62)

[Back to BioLiP]