Structure of PDB 8u5h Chain Q Binding Site BS02

Receptor Information
>8u5h Chain Q (length=83) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8u5h Chain H (length=157) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctccaggatg
tttacgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u5h Cryo-EM structure of human DNMT3A N-terminal domain bound to H2AK119Ub nucleosome
Resolution3.23 Å
Binding residue
(original residue number in PDB)		R45 I46 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R26 I27 G29 R59 K60 T61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8u5h, PDBe:8u5h, PDBj:8u5h
PDBsum8u5h
PubMed
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]