Structure of PDB 8rg0 Chain Q Binding Site BS02

Receptor Information
>8rg0 Chain Q (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIS
EASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPR
Ligand information
>8rg0 Chain A (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacggccgggggcauucgcggaccagagcggcauuugccaagaauguuu
ugcgaugcggcggcguugacccgccgggcagcuaaggguggugauggcgu
ucagccaguccuuuaucauua
.<<<<..<...<<<<..<..>.......<<.>>...>>>>..>..>>>.>
.<<..<.<<<<<<.<<..>>>>>>>>.>..>>.<<..........<<<..
...>>>.....>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R5 R6 N7 G9 A11 K13 G14 R15 G16 H17 Q19 K32 K34 K37 K38 F39 V75 I79 K82 V84 R85 N86 R87 S88 R89 R92 K93 D94 R95 T96 P97 P98 R100
Binding residue
(residue number reindexed from 1)		R1 R2 N3 G5 A7 K9 G10 R11 G12 H13 Q15 K28 K30 K33 K34 F35 V71 I75 K78 V80 R81 N82 R83 S84 R85 R88 K89 D90 R91 T92 P93 P94 R96
External links
PDB RCSB:8rg0, PDBe:8rg0, PDBj:8rg0
PDBsum8rg0
PubMed
UniProtP62854|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)

[Back to BioLiP]