Structure of PDB 8rbx Chain Q Binding Site BS02

Receptor Information
>8rbx Chain Q (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGKVTIAQGGVLPN
IQAVLLPKK
Ligand information
>8rbx Chain T (length=161) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcgatatcgg
ccaccacccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rbx Structural basis of Integrator-dependent RNA polymerase II termination
Resolution4.1 Å
Binding residue
(original residue number in PDB)
A12 K13 A14 K15 R17 V27 G28 R29 R32 R42
Binding residue
(residue number reindexed from 1)
A2 K3 A4 K5 R7 V17 G18 R19 R22 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8rbx, PDBe:8rbx, PDBj:8rbx
PDBsum8rbx
PubMed38570683
UniProtP02262|H2A1_RAT Histone H2A type 1

[Back to BioLiP]