Structure of PDB 8ooa Chain Q Binding Site BS02

Receptor Information

>8ooa Chain Q (length=98) Species: 9606 (Homo sapiens)

KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER

Ligand information

>8ooa Chain L (length=102)

tccccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcg
gtgctagagcttgctacgaccaattgagcggcctcggcaccgggattctc
ca

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ooa Hexasome-INO80 complex reveals structural basis of noncanonical nucleosome remodeling.
• Resolution: 3.18 Å
• Binding residue (original residue number in PDB): H39 Y41 R42 P43 T45 R83 F84 R116 V117 T118
• Binding residue (residue number reindexed from 1): H3 Y5 R6 P7 T9 R47 F48 R80 V81 T82

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0045296 cadherin binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0010467 gene expression
• GO:0032200 telomere organization
• GO:0040029 epigenetic regulation of gene expression

Cellular Component

• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:8ooa, PDBe:8ooa, PDBj:8ooa
• PDBsum: 8ooa
• PubMed: 37384673
• UniProt: P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)