Structure of PDB 8jww Chain Q Binding Site BS02

Receptor Information
>8jww Chain Q (length=32) Species: 1977402 (Inovirus M13) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
Ligand information
>8jww Chain S (length=29) Species: 1977402 (Inovirus M13) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADFDTIYQAMIQISVVLCFALGIIAGGQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jww Cryo-EM structure of a bacteriophage M13 mini variant
Resolution3.5 Å
Binding residue
(original residue number in PDB)		M1 V3 L4 F8
Binding residue
(residue number reindexed from 1)		M1 V3 L4 F8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0016020 membrane
GO:0033644 host cell membrane
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:8jww, PDBe:8jww, PDBj:8jww
PDBsum8jww
PubMed
UniProtP69538|G9P_BPM13 Tail virion protein G9P (Gene Name=IX)

[Back to BioLiP]