Structure of PDB 8ch6 Chain Q Binding Site BS02

Receptor Information

>8ch6 Chain Q (length=100) Species: 9606 (Homo sapiens)

SQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAARE
KNFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Ligand information

>8ch6 Chain e (length=98)

gguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuuccg
uggagaggaacaaucugagauuuuuugaggccuugcuuuggcaaggcu

.<<<<<<<<<<.........<<<<<<<<...........>>>>>>>>...
.>>>>>>>>>>.................<<<<<<<......>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ch6 Structural basis of catalytic activation in human splicing.
• Resolution: 5.9 Å
• Binding residue (original residue number in PDB): S32 R33 P36 S37 H38 T39 K40
• Binding residue (residue number reindexed from 1): S9 R10 P13 S14 H15 T16 K17

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005739 mitochondrion
• GO:0016607 nuclear speck
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:8ch6, PDBe:8ch6, PDBj:8ch6
• PDBsum: 8ch6
• PubMed: 37165190
• UniProt: Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)