Structure of PDB 8aye Chain Q Binding Site BS02

Receptor Information

>8aye Chain Q (length=79) Species: 562 (Escherichia coli)

KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKA

Ligand information

• Ligand ID: MG
• InChI: InChI=1S/Mg/q+2
• InChIKey: JLVVSXFLKOJNIY-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Mg+2]
  CACTVS 3.341: [Mg++]
• Formula: Mg
• Name: MAGNESIUM ION
• DrugBank: DB01378
• PDB chain: 8aye Chain Q Residue 101

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8aye Antibiotic thermorubin tethers ribosomal subunits and impedes A-site interactions to perturb protein synthesis in bacteria.
• Resolution: 1.96 Å
• Binding residue (original residue number in PDB): S68 K69
• Binding residue (residue number reindexed from 1): S65 K66
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8aye, PDBe:8aye, PDBj:8aye
• PDBsum: 8aye
• PubMed: 36806263
• UniProt: P0AG63|RS17_ECOLI Small ribosomal subunit protein uS17 (Gene Name=rpsQ)