Structure of PDB 7unr Chain Q Binding Site BS02

Receptor Information
>7unr Chain Q (length=115) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVKKETRLRRARKARLKMRELETVRLCVYRSSQHIYAQVIAADGGKVLAS
ASTLDKDLREGATGNIDAAKKVGQLVAERAKAAGVTQVAFDRSGFKYHGR
VKALADAAREGGLEF
Ligand information
>7unr Chain B (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuugacgaucauagagcguuggaaccaccugaucccuucccgaacucag
aagugaaacgacgcaucgccgaugguaguguggggucuccccaugugaga
guaggucaucgucaagc
<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>>
..>>>...>>>>>>.>><<<.......<<<<<<<<...>>>>>>>>....
...>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Resolution2.9 Å
Binding residue
(original residue number in PDB)
S2 K4 R16 R20 R26 Y30 R31 S32 S33 Q34 H35 Y37 I41 G45 V48 S51 K57 N66 I67 H99 G100 R101
Binding residue
(residue number reindexed from 1)
S1 K3 R15 R19 R25 Y29 R30 S31 S32 Q33 H34 Y36 I40 G44 V47 S50 K56 N65 I66 H98 G99 R100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum7unr
PubMed
UniProtQ9HWF1|RL18_PSEAE Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]