Structure of PDB 7ubn Chain Q Binding Site BS02

Receptor Information
>7ubn Chain Q (length=207) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRLESVAKFHSPKSPMMSDSPRATASDSLSGTDVMAAMGMAQSQAGFGMA
AFCGKHELSQNDKQKAINYLMQFAHKVSGKYRGVAKLEGNTKAKVLQVLA
TFAYADYCRSAATPGARCRDCHGTGRAVDIAKTELWGRVVEKECGRCKGV
GYSRMPASAAYRAVTMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADN
ILNAVTR
Ligand information
>7ubn Chain 2 (length=52) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
accacaacgagttacctctccaagtgtcaaatttacccaattttattcaa
ta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ubn In transcription antitermination by Q lambda , NusA induces refolding of Q lambda to form a nozzle that extends the RNA polymerase RNA-exit channel.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		V128 K142 R154 P156 A157 S158 R162 Q173 S177 R178 K181
Binding residue
(residue number reindexed from 1)		V128 K142 R154 P156 A157 S158 R162 Q173 S177 R178 K181
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7ubn, PDBe:7ubn, PDBj:7ubn
PDBsum7ubn
PubMed35951650
UniProtP03047|REGQ_LAMBD Antitermination protein Q (Gene Name=Q)

[Back to BioLiP]