Structure of PDB 7d98 Chain Q Binding Site BS02

Receptor Information

>7d98 Chain Q (length=288) Species: 106590 (Cupriavidus necator) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLER
SHRGIELTAAGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGT
PIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFP
RHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPSFADE
VIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIA
FARIVGTRVKVPISCIFRKEKQPPILARFVEHVRRSAK

Ligand information

>7d98 Chain H (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgccatgccgtccaatatgcgtaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7d98 Crystal structure of the full-length LysR-type transcription regulator CbnR in complex with promoter DNA.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	M18 A19 P30 T33 R50 H52 G54
Binding residue (residue number reindexed from 1)	M18 A19 P30 T33 R50 H52 G54

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7d98, PDBe:7d98, PDBj:7d98
PDBsum	7d98
PubMed	33576566
UniProt	Q9WXC7

[Back to BioLiP]