Structure of PDB 7cvq Chain Q Binding Site BS02

Receptor Information
>7cvq Chain Q (length=86) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKC
QKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cvq Structural insights into the multivalent binding of the Arabidopsis FLOWERING LOCUS T promoter by the CO-NF-Y master transcription factor complex.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K50 I51 S52 K53 R83 K84
Binding residue
(residue number reindexed from 1)		K22 I23 S24 K25 R55 K56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cvq, PDBe:7cvq, PDBj:7cvq
PDBsum7cvq
PubMed33693873
UniProtQ9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 (Gene Name=NFYB2)

[Back to BioLiP]