Structure of PDB 7as9 Chain Q Binding Site BS02

Receptor Information
>7as9 Chain Q (length=135) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNRQIEAA
RIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPG
KVLFEISGVSEEVAREALRLASHKLPIKTKFVKRE
Ligand information
>7as9 Chain B (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa
<<<<<<<....<<<<<<<<.....<<<<<<.............>>>>..>
>....>>>>>>.>>.<<.....<.<<.<<<<<...>>>>>.>>...>...
>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7as9 Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
K16 M17 R18 G19
Binding residue
(residue number reindexed from 1)
K16 M17 R18 G19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7as9, PDBe:7as9, PDBj:7as9
PDBsum7as9
PubMed33259810
UniProtP14577|RL16_BACSU Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]