Structure of PDB 6y5d Chain Q Binding Site BS02

Receptor Information
>6y5d Chain Q (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>6y5d Chain V (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcacaggatgtatatatctgacacgtgcctggagactagggagtaatcc
ccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtg
ctagagctgtctacgaccaattgagcggcctcggcaccgggattctccag
gat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y5d Structural mechanism of cGAS inhibition by the nucleosome.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		Y42 R43 T46 R64 R73 R84 F85 V118 T119 M121
Binding residue
(residue number reindexed from 1)		Y2 R3 T6 R24 R33 R44 F45 V78 T79 M81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6y5d, PDBe:6y5d, PDBj:6y5d
PDBsum6y5d
PubMed32911482
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]