Structure of PDB 5ylz Chain Q Binding Site BS02

Receptor Information
>5ylz Chain Q (length=201) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTDQIAKNVKLDDFIPKRQSNFELSVPLPTKAEIQECTARTKSYIQRLVN
AKLANSNNRASSRYVAPANLLLNNSHHIEVVSKQMDPLLPRFVGKKARKV
VAPTENDEVVPVLHMGEADPNEWKIPAAVSNWKNPNGYTVALERRVENNT
INDGFMKLSEALENADKKARQEIRSKMELKRLAMEQEMLAKESKLKELSQ
R
Ligand information
>5ylz Chain F (length=91) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuuu
caacauuuuuuggcaccgcgacccucgcacuuguggagucg
..................................................
................<<...<<...........>>...>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ylz Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
Resolution3.6 Å
Binding residue
(original residue number in PDB)
N174 P175 N176 Y178
Binding residue
(residue number reindexed from 1)
N134 P135 N136 Y138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0000386 second spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5ylz, PDBe:5ylz, PDBj:5ylz
PDBsum5ylz
PubMed29153833
UniProtP28004|PRP45_YEAST Pre-mRNA-processing protein 45 (Gene Name=PRP45)

[Back to BioLiP]