Structure of PDB 4h62 Chain Q Binding Site BS02

Receptor Information
>4h62 Chain Q (length=271) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HSVKKFLRVRIFTKIESEDDYILSGESVMDRDIRKQIQLLKKIIFEKELM
YQIKKECALLISYGVSIENENKVIIELPNEKFEIELLSLDDDLPKINDKR
ANLMLVMLRLLLVVIFKKTLRSRISSPHGLINLNVDDDILIIRPILGKVR
FANYKLLLKKIIKDYVLDIVPGSSITETEVENITKLNKEIRAFDKLLNIP
RRELKINLPLTEHKSPNLSLMLESPNYCNALIHIKFSAGTEANAVSFDTT
FSDFKEVEDFLHFIVAEYIQQ
Ligand information
>4h62 Chain V (length=22) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEKQIEELLDNCIETFVAEKTT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h62 Structure of the Mediator head module.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R500 M504 M507 I545 K555 K601 R604 A605 K608 L609
Binding residue
(residue number reindexed from 1)		R100 M104 M107 I145 K155 K188 R191 A192 K195 L196
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0016592 mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h62, PDBe:4h62, PDBj:4h62
PDBsum4h62
PubMed23123849
UniProtP32569|MED17_YEAST Mediator of RNA polymerase II transcription subunit 17 (Gene Name=SRB4)

[Back to BioLiP]