Structure of PDB 3ccj Chain Q Binding Site BS02

Receptor Information
>3ccj Chain Q (length=95) Species: 2238 (Haloarcula marismortui) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNG
RFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Ligand information
>3ccj Chain 9 (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuaggcggccacagcggugggguugccucccguacccaucccgaacacgg
aagauaagcccaccagcguuccagggaguacuggagugcgcgagccucug
ggaaauccgguucgccgccacc
...<<<<<<....<<<<<<<<......<<<<<...............>>>
..>>....>>>>>>.>><..<<.<<.....<<<<<<.<<....>>>>>>>
>....>>.>>.>.>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ccj Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R19 P25 Q27
Binding residue
(residue number reindexed from 1)		R19 P25 Q27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ccj, PDBe:3ccj, PDBj:3ccj
PDBsum3ccj
PubMed18455733
UniProtP12734|RL21_HALMA Large ribosomal subunit protein eL21 (Gene Name=rpl21e)

[Back to BioLiP]