Structure of PDB 5it7 Chain PP Binding Site BS02

Receptor Information

>5it7 Chain PP (length=180) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RYGATSTNPAKSASARGSYLRVSYKNTRETAQAISGWNLQKAQKYLDQVL
DHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAASNA
EAKGLDATRLYVSHIQVNQAPKQRRRTFRAHGRINKYESSPSHIELVVTE
KEEAVEKASEKKVARLSSRQRGRLATQKRI

Ligand information

>5it7 Chain 8 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaauugcgauauguauugugaauugcagauuuucgugaaucaucaaaucu
uugaacgcacauugcgcccucugguauuccagggggcaugccuguuugag
cgucauu

.........................................<<<<<<<((
....>>>>.....<..<<......))..............>>...>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	Y4 G5 A6 R30 R61 R62 Q118 N120 Q121 P123
Binding residue (residue number reindexed from 1)	Y2 G3 A4 R28 R59 R60 Q116 N118 Q119 P121

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5it7, PDBe:5it7, PDBj:5it7
PDBsum	5it7
PubMed	27159451
UniProt	Q6CXQ6

[Back to BioLiP]