Structure of PDB 6t59 Chain P3 Binding Site BS02

Receptor Information

>6t59 Chain P3 (length=153) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT
EKE

Ligand information

>6t59 Chain 84 (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcagguugaucaucgacacuucgaac
gcacuugcggccccggguuccucccggggcuacgccugucugagcgucgc
u

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>........>>>..>...>>>....
<<<..>>><<<<<<<<.......>>>>>>>>...................
.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6t59 TTC5 mediates autoregulation of tubulin via mRNA degradation.
Resolution	3.11 Å
Binding residue (original residue number in PDB)	Y4 S5 R61 R62 W78 N120 K121
Binding residue (residue number reindexed from 1)	Y3 S4 R60 R61 W77 N119 K120

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6t59, PDBe:6t59, PDBj:6t59
PDBsum	6t59
PubMed	31727855
UniProt	G1SCJ6\|RL17_RABIT Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]