Structure of PDB 8ckb Chain P004 Binding Site BS02

Receptor Information
>8ckb Chain P004 (length=107) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKMLEISEEAITRYFTTLSQFGYKKYSDVDKIIVLFFMEEMLAGEMSYY
VTQDDYRNIVNALYCLAGSTCMIDFPMFESYDTLVHSNNRTFVPRITEDS
ILRSTED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ckb Structural atlas of the most abundant human gut virus
Resolution4.39 Å
Binding residue
(original residue number in PDB)
R90 F92 R95 R103 S104 E106 D107
Binding residue
(residue number reindexed from 1)
R90 F92 R95 R103 S104 E106 D107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:8ckb, PDBe:8ckb, PDBj:8ckb
PDBsum8ckb
PubMed
UniProtA0A385DTH1|THA_BPCA1 Tail hub protein A (Gene Name=crAss001_38)

[Back to BioLiP]